Identification of Neuroactive Peptide from Venomous Species using Structural Analysis: A Possible Neuronal Therapeutic Candidate

 

Chandrappa Chinna Poojari1, Sanjana1, Levin Anbu Gomez2, Saba Shirin3,4, Ankit Kumar5, Gangadahosahalli Krishnegowda Puneetha6, Praveen Kumar Guttula7, Rajkumar Sekar8, Prathap Somu9*, Akhilesh Kumar Yadav10,11*

1Department of Microbiology, Shridevi Institute of Allied Health Sciences, Tumakuru, 572106, India.

2Division of Biotechnology, School of Agricultural Sciences, Karunya Institute of Technology and Sciences, Karunya Nagar, Coimbatore, 641114, India.

3Department of Environmental Science, School of Vocational Studies and Applied Sciences,

Gautam Buddha University, Greater Noida, 201312, India.

4Department of Mining Engineering,

Indian Institute of Technology (Banaras Hindu University), Varanasi, 221005, India.

5Lohum Cleantech Pvt. Ltd., Kasna Industrial Area, D-184, Site V, Greater Noida, 201306, India.

6Department of Botany, Yuvaraja’s College, University of Mysore, Mysuru, 570005, India.

7Sprott Centre for Stem Cell Research, Ottawa Hospital Research Institute, Ottawa, ON K1Y 4E9, Canada.

8Department of Chemistry, Karpaga Vinayaga College of Engineering and Technology,

Chengalpattu, 603308, India.

9Department of Biotechnology and Chemical Engineering,

School of Civil and Chemical Engineering, Manipal University Jaipur, Jaipur, 303007, India.

10Department of Environmental Engineering and Management,

Chaoyang University of Technology, Taichung, 413310, Taiwan.

11Department of Bioengineering, Saveetha School of Engineering,

Saveetha Institute of Medical and Technical Sciences, Chennai 602105, India.

*Corresponding Author E-mail: yadavbasti@gmail.com, prathaps1987@gmail.com

 

ABSTRACT:

Neuroactive peptides derived from venomous species have proven to be used as a lead compound for treating neurological diseases. In the present study, the primary structure of the peptide toxins of snakes, scorpions, spiders, cone snails, honey bees, and sea anemones was recovered from different toxin databases. The 3-D structures of the peptide toxins were analyzed with respect to secondary structural elements such as cysteine patterns and disulfide connectivity’s using PYMOL. Their interaction with ion channels/receptors was studied because of its pharmacological importance. The toxins retrieved were found to have – C–Xn–C–Xn–CC–Xn–C–Xn–C-- cysteine pattern for n≥1 that was the same --C---C---CC---C---C— cysteine pattern of ω-conotoxin and hanatoxin, but with a varying intervening non-cysteine residue between cysteines. Hence, these provide insight for structure-based drug design using these peptide toxin scaffolds. Given the optimal molecular weight and specificity of peptides compared to conventional small molecule drugs, peptides are considered future next-generation drug candidates.

 

KEYWORDS: Venomous species, Peptide toxin, Neurological disorders, Intramolecular disulfide folds, Ion channels/receptors.

 

 


INTRODUCTION: 

Diverse modes have evolved to achieve fundamental aspects of adaptation in life, feeding, and defense. One of the critical modes of adaptation is through chemical communication. Like plants use alkaloids and microorganisms use secondary metabolites, certain venomous animals such as spiders, scorpions, snakes, sea anemones, and cone snail uses peptide toxins to interact with the surrounding environment. The reason why these species to have peptide toxins in the venom is for prey immobilization or defend them by targeting the neuronal circuits of the fatalities 1-5. Dissection of venom of cone snail alone has given valuable lead compounds for therapeutics. As a variety of defense strategies, the venom of venomous species contains a rich collection of potential pharmacological molecules to treat neurological disorders. Decades of research on the structural and functional characterization of venom peptides have provided a lot of information on the use of peptide toxins in the treatment of various neurological disorders. ω-conotoxin MVIIA derived from Conus magus is being used for the treatment of intractable pain under generic name Prialt. Peptide toxins not only directly serve as drugs for the treatment of disorders, but also serve as templates for the design of drug candidates. The drug ‘captopril’ was designed using snake toxin 6 Precise analysis of the structural features of peptide toxins provides information to use peptide toxins as templates for the design of drug candidates. This introductory section gives a brief overview of sequences, structures, and functions of peptide toxins derived.

 

The biologically active components of venom are peptide toxins, composed of acyclic and disulphide bonded peptides 7-9. The length of the peptide varies from 8 to 80 residues and contains multiple disulfide bonds, which vary from 1-5 intramolecular disulfide bonds. The characteristic feature of peptide toxins in the presence of multiple numbers of intramolecular disulfides along with a high degree of post-translational modifications 10. Peptide toxins can be broadly classified based on the number of intramolecular disulfides present in the given sequence, as one disulfide, two disulfides, three disulfides, four disulfides and more disulfides containing peptide toxins. Interestingly, the structural diversity of peptide toxins is due to intramolecular disulfide bonds. As the number of disulfides increases, the peptide toxins cysteine frameworks and disulfide isomers also increases tremendously, importing different structures from the peptide toxins. ‘cysteine pattern’ or ‘cysteine framework’ indicates cysteine residues arrangement where cysteine residues are present in even number in the given sequence. Specific disulfide connectivity between participating cysteine residues in the sequence results in unique disulfide isomers 11. For example, peptide toxins may have the cysteine pattern –C1--Xn—C2--Xn—C3C4--Xn—C5--Xn—C6—and have selective disulfide connectivity between C3-C6, C2-C5, and C1-C4.

 

Change in disulfide connectivity imparts altered 3D-structure to the identical polypeptide. Interestingly, similar cysteine patterns and disulphide connectivities are observed across different venomous species. For example, —C1 — Xn —C2 — Xn — C3 — Xn — C4 — cysteine pattern has been observed in cone snail’s ω- conotoxin, scorpion’s ω-hemotoxin and sarafotoxin derived from snakes with the disulfide connectivity at C1 - C3 and C2 - C4.

 

Publically accessible and readily reachable toxin databases for toxin of various venomous animals annotation ConoServer 12, Uniprot 13, ArachnoServer 14, and Animal toxin database 15 have categorized and catalogued peptide toxins into different superfamilies based on signal sequence and cysteine pattern of peptide toxins. These databases readily provide information about the sequence, structure, and function of peptide toxins and thus serve as a platform for computational analysis of peptide toxins. In general, depending on the research project, the source of 3D structures used for finding cysteine patterns can vary. High-resolution 3D structures of proteins and peptides can be obtained using experimental techniques such as X-ray crystallography and NMR spectroscopy, and these structures are frequently stored in the PDB database.

 

Protein and peptide structures can also be predicted using computational approaches such as AlphaFold. Although predicted structures may not be as accurate as experimentally established structures, they can provide useful insights into the structural characteristics of proteins and peptides.

 

X-ray crystallography, NMR spectroscopy, and cryogenic electron microscopy (Cryo-EM) are a few structural analysis methods that can be utilised to understand the three-dimensional (3D) structures of neuroactive peptides from venomous species. Once a neuroactive peptide's structure is understood, it can be used as a model to create new treatment candidates with increased activity and selectivity. The computer-aided software techniques in simplifying and deriving fruitful information has already proven and established independent discipline of ‘Bioinformatics’ in the field of biological sciences. The current work utilized powerful bioinformatics tools in deriving useful information from naturally designed neuroactive peptide toxins, which may serve as guiding principles for ‘de novo’ designing of novel molecules for the treatment of neurological diseases.

 

MATERIALS AND METHODS:

Analysis of peptide toxins:

Analysis of peptide toxins deposited in Animal toxin annotation project of Uni Prot :

UniProt (http://www.uniprot.org/program/Toxins) has an extensive data of the manually annotated venomous species peptide toxins. UniProt database comprises records of more than 5703 manually curated peptide toxins. Each of the toxin entry contains information about amino acid sequence, gene sequence, 3D structure, and biological target. Entries in the database have been scrutinized manually based on the information concerning disulfide connectivity, cysteine patterns, number of disulfide bonds, structural fold, and target. Cysteine patterns have been determined through the analysis of the amino acid sequence of the toxin. The number of intervening amino acids has been studied to deduce the pattern eventually. For example, the amino acid sequence of ‘Maurocalcin’ is GDCLPHLKLCKENKDCCSKKCKRRGTNIEKRCR. The cysteine pattern of ‘Maurocalcin’ is ----X2-----C-----X6-------C----X5----CC----X3-----C-----X10-----C---X1 3D-fold of the peptide toxin has determined by identifying the secondary structural features such as alpha-helix and beta-sheet. Finally, the identification of biological targets for each peptide toxins has been performed.

 

Analysis of peptide toxins deposited in Cono Server:

ConoServer (www.conoserver.org/) has an extensive collection of peptide toxins derived from Cone snails. It is a dedicated database for conotoxins. Nearly all the conotoxins that were characterized thus far are available in ConoServer. The database contains the amino acid sequence, gene sequence, 3D-structure, and biological target of conotoxins. The sequences of conotoxins have been manually verified, and information was collected concerning disulfide connectivity, cysteine patterns, number of disulfide bonds, structural fold, and target. Interestingly, the database categorized conotoxins based on cysteine pattern, gene superfamilies, and pharmacological target. Cysteine patterns were determined through the analysis of the amino acid sequence of conotoxin, and also, the number of intervening amino acids was found, and eventually, the pattern was deduced. For example, the amino acid sequence of ‘α-conotoxin’ is DECCPDPPCKASNPDLCDWRS. The cysteine pattern of ‘α-conotoxin’ is ----X2-----CC-----X4-------C----X7---- C---X4 3D-fold of the peptide toxin was studied by identifying the secondary structural features such as alpha-helix and beta-sheet. Biological targets were analyzed for each of the peptide toxins.

 

Analysis of peptide toxins deposited in Aracno Server:

AracnoServer (http://www.arachnoserver.org/)has an extensive information about the peptide toxins derived from spiders and a dedicated database for spider toxins. Nearly all the spider toxins that are characterized thus far are available in AracnoServer. The database contains the amino acid sequence, gene sequence, 3D-structure, and biological target of spider toxins. Sequences of spider toxins were manually verified, and information was collected corresponding to the number of disulfide bonds, cysteine patterns, disulfide connectivity, structural fold, and target. Interestingly, the database categorized spider toxins based on the cysteine pattern and pharmacological target. Cysteine patterns were determined through the analysis of the amino acid sequence of conotoxin. The number of intervening amino acids was determined, and eventually, the pattern was deduced. For example, the amino acid sequence of ‘Hanatoxin’ is CLPPGKPCYGATQKIPCCGVC-SHNNCT. The cysteine pattern of ‘Hanatoxin’ is ----C-----X6-------C----X8----CC----X2-----C-----X4-----C---X1.. 3D-fold of the peptide toxin was determined by identifying the secondary structural features such as alpha-helix and beta-sheet. Finally, the identification of biological targets for each peptide toxins has been performed.

 

Analysis of peptide toxins deposited in Animal toxin database:

Animal toxin database (http://protchem.hunnu.edu.cn/toxin/)has an extensive information about the manually annotated peptide toxins obtained from numerous venomous animals. The database contains a limited number of entries of peptide toxins. Each of the toxin entry contains information about amino acid sequence, gene sequence, 3D-structure, and biological target. Entries in the database were manually inspected, and information was drawn for disulfide connectivity, cysteine patterns, the number of disulfide bonds, structural fold, and target. Cysteine patterns were determined through the analysis of the amino acid sequence of the toxin. The number of intervening amino acids was calculated, and eventually, the pattern was deduced. For example, the amino acid sequence of snake toxin Crotamine’ is QCHKKGGHCFPKEKICIPPSSDFGKMDCRWRWKCCKKGSGK. The cysteine pattern of Crotamine’ is ----X1-----C-----X6-------C----X6----C----X11-----C-----X5-----CC---X6. 3D-fold of the peptide toxin was determined by identifying the secondary structural features such as alpha-helix and beta-sheet. A biological target was noted for each of the peptide toxins.

 

3D-Structure processing using PyMOL:

The structures of peptide toxins were downloaded from Protein Databank (PDB). 3D structures of toxins were analyzed using PyMOL viewer. The procedure for viewing 3D structure of peptide toxins is as follows- Upon opening PDB structure in PyMOL, using the cartoon display option and ball & stick representation of disulfides, the structures were processed. Upon displaying line representation of the side chain of toxin and using Ray option, the structures were saved in image format.

RASA Calculation for cysteines in peptide toxins:

ASA-View tool (http://www.abren.net/asaview/) was utilized to compute the Relative Accessible Surface Area (RASA) of peptide toxins before and after binding to the ion channels/receptor. The representative PDB files of peptide toxins and receptor-bound toxins were downloaded from PDB. The coordinates file of each of the toxins is uploaded separately to the ASA-View server. The output obtained from RASA analysis encompasses a text file with the bar chart, and spiral plot along with the information on RASA values (%) of individual amino acid residues utilized for further analysis. The difference in the RASA value of each of the amino acids was determined to identify the interacting surface of the toxin with the ion channel/receptor. Similarly, in an approach of identifying the interacting surface of the toxin with ion channel/receptor using PyMOL, surrounding residues of 4A° to toxin were analyzed and marked.

 

RESULT AND DISCUSSION:

Peptide toxins have unique features of harbouring multiple numbers of intramolecular disulfides. The importance of disulfide bonds on the functions and structures of toxic peptides is well established. Given the critical role of disulfides in peptide toxins, cysteine patterns were analyzed and disulphide connectivities of peptide toxins were collected in peptide toxins databases. Due to uncertainties and complications in complying with the data related to the disulfide mapping in higher-order disulfide toxins, the analysis of toxins was restricted to four disulfides 16, 17. Intensive research in the area of venomics has discovered a huge quantity of information about the peptide toxins sequence, peptide toxins structure, and their functions that were deposited in multiple public databases such as ArachnoServer, ConoServer, Animal toxin annotation project of Uniprot, and Animal toxin database. Analyses of cysteine pattern and disulphide connectivity were performed as reported in the methodology section.

 

Briefly, manual scrutiny of toxins present in the databases was studied to determine cysteine pattern and disulphide connectivity and subsequently classified concerning the number of intramolecular disulfides in the sequence. Venomous species of snake, scorpion, spider, cone snail, and sea anemone peptide toxins were well-studied for cysteine patterns and disulphide connectivities. There are reports that toxic peptides (where n≥1) with cysteine pattern – C – Xn –C – Xn – CC –Xn – C – Xn – C -- were deliberated to have the identical cysteine pattern – C --- C --- CC --- C --- C —. For instance, ω-conotoxin and hanatoxin have a dissimilar number of intervening non-cysteine residues between cysteines, but the same cysteine pattern --C---C---CC---C---C—was observed. There are more entries of similar toxins in the database, and all of them were having the same cysteine pattern. ~150 entries of ω-conotoxins obtained from different cone snail species had cysteine pattern --CC----C----C--, whereas nearly ~156 entries of short neurotoxins were also found to have a pattern --C—C—C—C—C—CC— C were—. However, each entry of toxin has been further scrutinized to know its molecular target, 3D structure, and disulfide connectivity. The following section provides a summary of the analysis concerning the venomous species snake, scorpion, spider, cone snail, and sea anemone.

 

Snake Venom Peptide Toxins:

Table S1 provides the classification of snake venom peptides based on cysteine patterns and disulfide connectivity’s. Single disulfide containing snake venom peptide toxin is a natriuretic peptide, which is a critical lead compound for cardiovascular diseases. A total of eight cysteine patterns was observed in snake peptide toxins: --C---C---C---C--; --CC---C---C--; --C--C--C--C--C--C--; --C--C--C--C--CC--; --C-C-C-C-C-CC-C--; --C-C-C-C-CC-C-C--; --C-CC-C-C-C-C-C--; and --C-C-C-C—C-CC-C--. These patterns contribute to a total of nine (9) disulfide folds. Pattern --C---C---C---C—with connectivity 1-2/3-4 and 1-4/2-3; pattern--C--C--C--C--C--C—with connectivity 1-6/2-4/3-5 and 1-2/3-6/4-5; pattern --C--C--C--C--CC— with connectivity 1-5/2-4/3-6; pattern --C-C-C-C-C-CC-C—with connectivity 1-3/2-4/5-6/7-8; pattern --C-C-C-C-CC-C-C—with connectivity 1-5/2-7/3-5/4-8; pattern --C-CC-C-C-C-CC— with connectivity 1-4/2-6/3-7/5-8 and pattern --C-C-C-C—C-CC-C—with connectivity 1-3/2-4/5-6/7-8. Disulfide connectivity of cardiotoxin-like basic polypeptide ah needs to be established (Table S1). Fig. 1 shows representative 3D structures of snake venom peptide toxins.

 

Safarotoxin is an agonist of EDNRA/EDNRB receptor (Endotheline receptor), which is a particular class of G-protein coupled receptors. This peptide toxin has a cysteine stabilized alpha-helical motif. Dendrotoxin-1 blocks Kv channels at picomolar to nanomolar concentration range and has 310ββα disulfide fold. C-type lectin 6 modulates platelet aggregation. Myotoxin-A is a cell-penetrating peptide with disulfide fold αβββ. This toxin is also Nav channel modulators. Three-finger hemachatoxin has cardiotoxic and hypotensive activities. Another three-finger toxin (Toxin-FS2) have reported to act as a specific blocker of L-type Cav channel. These snake toxins have ββββββ disulfide fold (TableS2). Nawaprin with disulfide fold βαβββ shows antimicrobial activity. Disintegrinjerdostatin with βββ fold shows inhibition of adhesion of alpha-1/beta-1-K562.

 

Scorpion Venom Peptide Toxins:

Table S2 provides the classification of snake venom peptides based on cysteine patterns and disulfide connectivities. A total of seven cysteine patterns has been observed in scorpion peptide toxins: --C--C--CC--C--C--; --C--C--C--C--C--C--; --C-C-C-C-C-CC-C--; --C-C-C-C-C-CC-C--; --C-C-CC-C-C-C-C--; --C-C-C-CC-C-C-C--; and --CC-C—C-C-C-C-C--. These patterns contribute to a total of twelve (12) disulfide folds - Cysteine pattern --C--C--CC--C--C— with connectivity 1-4/2-5/3-6; pattern --C--C--C--C--C--C—with connectivity 1-4/2-5/3-6; pattern --C-C-C-C-C-CC-C—with connectivity 1-3/2-6/4-7/5-8; pattern --C-C-C-C-C-C-CC— with connectivity 1-8/2-5/3-6/4-7; 1-2/3-6/4-7/5-8; 1-5/2-6/3-7/5-8; 1-5/2-6/3-4/7-8 and 1-4/2-5/3-6/7-8; pattern --C-C-CC-C-C-C-C—with connectivity 1-4/2-8/3-6/5-7; and pattern --C-C-C-CC-C-C-C—with connectivity 1-4/2-6/3-7/5-8. Disulfide connectivity of putative potassium channel blocker toxins is yet to be established. Fig. 2 shows representative 3D structures of scorpion venom peptide toxins. Maurocalcin with disulfide fold βαβββ (Inhibitory cystine knot motif) potently and reversibly modifies RYR1 receptors. Charybdotoxin and Toxin ImKTx104 with disulfide fold αββ target Kv channel. Kappabuthitoxin- Tt2b with disulfide fold αα blocks sheker and hKv1.2 channel. Potassium channel toxin alpha-KTx 10.2 targets sheker-B Kv channels.

 

Neurotoxin 2 with disulfide fold βαββ binds site-3 of Nav channels. Butantoxin with disulfide fold βαββ inhibits calcium-activated Kv channels. Toxin Vm24 with disulfide fold ββαβ blocks hKv1.3/KCNA3 potassium channels. Maurotoxin with disulfide fold αββ blocks Kv channel. Phaiodotoxin is Nav channel-specific neurotoxin. Potassium channel toxin epsilon-KTx 1.1 with ββββ fold blocks Kv channels. Beta-insect excitatory toxin Bj-xtrIT with βααββα bind Nav channels.

 

Fig. 1. Representative 3D-structures of peptide toxins derived from snake venom with its PDB ID. Cysteine disulfides are indicated by the ball and stick model. Structures were processed using PyMOL software.

 

Fig. 2. Representative 3D structures of peptide toxins derived from scorpion venom with its PDB ID. Cysteine disulfides are indicated by the ball and stick model. Structures were processed using PyMOL software.

 

Spider Venom Peptide Toxins:

Table S3 provides the classification of spider venom peptides based on cysteine pattern and disulfide connectivities. Totally Seven different cysteine pattern was detected in spider peptide toxins: --C--C--CC--C--C—; --C--C--C--C--C--C--; --C-C-C-C-C-C-C-C--; --C-C-CC-CCC- C--; --C-C-CC-C-C-C-C—; --C-C-C-CC-C-C-C—; and --C-C-CCC-C-C-C--. These patterns contribute to a total of twelve (13) disulfide folds - cysteine pattern --C--C--CC--C--C— with disulfide connectivity 1-4/2-5/3-6 and 1-4/2-6/3-5; cysteine pattern --C--C--C--C--C--C—with connectivity 1-5/2-4/3-6; 1-4/2-6/3-5; 1-3/2-5/3-6; and 1-3/2-6/4-5; cysteine pattern --C-C-C-C-C-C-C-C— with connectivity 1-3/2-7/4-5/6-8; cysteine pattern --C-C-CC-CC-CC—with connectivity 1-6/2-7/3-4/5-8; cysteine pattern --C-C-CC-C-C-C-C— with connectivity 1-4/2-5/3-8/6-7; 1-4/2-6/3-8/ 5-7; and 1-4/2-5/3-7/6-8; cysteine pattern --C-C-CCC-C-C-C—with connectivity 1-5/2-6/3-8/4-7; and cysteine pattern with connectivity 1-4/2-6/3-7/5-8. Kappa-hexatoxin-Hv1c with the pattern --C-C-CC-CC-C-C—and connectivity 1-6/2-7/3-4/5-8 contains a vicinal disulfide bond. Fig. 3 shows representative 3D-structures of spider venom peptide toxins.

 

 

 

Kappa-theraphotoxin-Gr1a (Hanatoxin-1) with disulfide fold 310 ββ (ICK motif) inhibits Kv channels. U1-agatoxin-Ta1a (Insecticidal toxin 1) with disulfide fold αααα shows insecticidal activity. U1-theraphotoxin-Hs1a (Huwentoxin-2) with disulfide fold ββββ blocks neuromuscular transmission. Kappa-hexatoxin-Hv1c with vicinal disulfides inhibits KCa channels. U2-hexatoxin-Hi1a (Agatoxin) with disulfide fold βββ Inhibits Nav channels. U2-segestritoxin-Sf1a with ββ fold is an insecticidal toxin. Deltahexatoxin- Hv1a (Delta-batrachotoxin) with βββ310 fold inhibits tetrodotoxin sensitive Nav channel.

 

Cone Snail Venom Peptide Toxins:

Table S4 provides the classification of cone snail venom peptides based on cysteine pattern and disulfide connectivities. In cone snail peptide toxins, a total of seventeen cysteine patterns has been observed as follows --C---C---C---C--; --CC---C---C--; --C---C---CC--; --CC-----CC--; --C--C--CC--C--C--; --CCC--C--C--C--; --C--C--CC--CC--; --CC--C--C--C--C--; --CC--C--C--CC--; --C--C--C--CC--C--; --C--CC--C--C--C--; --C-C-CC-CC-C-C--; --C-C-C-CCC-C-C--; --C-C-CC-C-C-C-C--; --C-C-C-C-CC-CC--; --C-C-C—C-C-CCC--; and --C—C-CC—C-CC-C--. These patterns contribute to a total of twelve (18) disulfide folds. Cysteine pattern --C--C--C--C—with disulfide connectivity 1-3/2-4 and 1-4/2-3; cysteine pattern --CC---C---C—with disulfide connectivity 1-3/2-4 and 1-4/2-3; cysteine pattern --C---C---CC—with disulfide connectivity 1-4/2-3; cysteine pattern --CC-----CC-- with disulfide connectivity 1-3/2-4; cysteine pattern --C--C--CC--C--C—with disulfide connectivity 1-4/2-5/3-6; cysteine pattern --CCC--C--C--C-- with disulfide connectivity 1-6/2-4/3-5; cysteine pattern --CC--C--C--C--C—with disulfide connectivity 1-3/2-5/4-6 and 1-5/2-3/4-6; cysteine pattern --CC--C--C--CC-- with disulfide connectivity 1-4/2-5/3-6; cysteine pattern --C--C--C--CC--C—with disulfide connectivity 1-2/3-4/5-6; cysteine pattern --C--C--C--CC--C— with disulfide connectivity 1-3/2-5/4-6; cysteine pattern --C--CC--C--C--C—with disulfide connectivity 1-3/2-5/4-6; cysteine pattern --C-C-CC-CC-C-C— with disulfide connectivity 1-4/2-6/3-7/5-8; and cysteine pattern --C-C-C-C-CC-C-C—with disulfide connectivity 1-3/2-6/4-7/5-8. The disulfide connectivity for the patterns --C-C-CC-C-C-C-C--; --C-C-C-C-CCCC--; --C-C-C—C-C-CCC--; and --C—C-CC—C-CC-C— yet to be established. Fig. 4 shows representative 3D structures of venom peptide toxins derived from cone snails. Alpha/kappa-conotoxin pl14a with disulfide α310310 fold inhibits Kv1.6 channels.

 

Kappa-conotoxin with αα fold blocks Kv channels. Alpha-conotoxin GI with alpha-helix inhibits nAChR. ChiconotoxinMrIA with ββ disulfide fold inhibits NET transporter. Conotoxin pc16a with β/α scaffold is a potent neurotoxin. Omega-conotoxin GVIA with βββ (ICK) fold inhibits the N-type Cav channel. Alpha-conotoxin S2 with αβ fold binds to nAChR. αA-conotoxin PIVA with βα fold inhibits nAChR. Mu-conotoxin GIIIA with βα fold blocks Nav channels. Iotaconotoxin RXIA ( r11a) with ββββ fold is agonists of Nav channels. Several conotoxins have reported to cause convulsions in mice by inducing excitatory symptoms and reversible depression symptoms.

 

Sea anemone and other peptide venom toxins:

Table S5 provides the classification of sea anemone venom peptides based on cysteine pattern and disulfide connectivities. A total of four cysteine patterns have been observed in sea anemone peptide toxins: --C--C--C--C--C--C--; --CC--C--C--C--C--; --C--C--C--C--CC--; and --CC-C-C-C-C-C-C--. Cysteine pattern --C--C--C--C--C--C—with connectivity 1-6/2-4/3-5; pattern --CC--C--C--C--C—with connectivity 1-5/2-4/3-6; and pattern --C--C--C--C--CC— with connectivity 1-5/2-4/3-6. Disulfide connectivity of the pattern --C-C-C-C-C-C-C-C— is yet to be established. Fig. 5 shows representative 3D structures of sea aneomone venom peptide toxins. Kappa-stichotoxin-She3a (Kappa-SHTX-She3a) with disulfide βααα fold inhibits Kv channels. Delta-actitoxin-Avd2a (ATX III) with disulfide βββ fold inhibits the inactivation of Nav channels. Delta-actitoxin-Avd1a with disulfide ββββ fold binds Nav channels. Notable other toxins of interest are cysteine stabilized alpha-helical peptide apamin, Horseshoe crab tachystatin-A1, centipede peptide ω-scoloptoxin, wasp toxin, and bug toxin(Ptu1). Peptide toxins of other neglected taxonomic lineages are of current interest. Comparing spiral disulfide conformers to the other three fundamental disulfide conformers of peptide toxins reveals a bias for greater DCa-Ca (>5) and lower DCb-Cb (4 ) values.

 

 

Fig. 3. Representative 3D-structures of peptide toxins derived from spider venom with its PDB ID. Cysteine disulfides are indicated by the ball and stick model. Structures were processed using PyMOL software.

 

Fig. 4. Representative 3D-structures of peptide toxins derived from cone snail venom with its PDB ID. Cysteine disulfides are indicated by ball & stick model. Structures were processed using PyMOL software.

 

Unity-diversity relationship of peptide toxins and channels/receptors:

Cone snails have utilized a single disulfide scaffold in designing three different functional toxins; κ-conotoxin, which targets the sodium channel, the κ- conotoxin which targets the potassium channel, and ω-conotoxin which targets the calcium channel as illustrated in Fig. 6.

 

Stable peptide scaffolds such as ICK motif have been utilized in designing new functional entities through surface modification other than the disulfide core resulting in identical disulfide folds in functionally diverse toxins. ICK motif has cysteine pattern ---C----C----CC----C----C--- and disulfide connectivity 1-4/2-5/3-6. Toxic peptides reported to contain ICK motifs are known to target RYR1 receptors, ASIC1a Channels, TRPV1 channels, voltage-gated Ca channels, voltage-gated K channels, voltage-gated Na channels, and microbes. As shown in Fig. 7, peptide toxin that targets the K+ channel is present in multiple venomous species such as snakes, scorpions, spiders, and cone snails. The utilization of identical folds having the same function in numerous venomous species and the evolution of several disulfide folds acting at the same target highlights the unity-diversity relationship in deadly peptide toxins. Similarly, sarafotoxin, κ-hefutoxin, are κ-Conotoxin were the few examples of toxic peptide with cysteine pattern ---C---C---C---C--- and disulfide connectivity 1-3/2-4 which obtained from snake scorpion, and cone snail, respectively.

 

There are reports of the presence of molecular targets in κ-Conotoxin for the endothelin receptor (EDNRA/EDNRB) as well as for the K+ channel. Numerous toxic peptides derived from different venomous species with similar mechanisms of inhibition of proteases were reported to have Kunitz disulfide folds with pattern ---C---C---C---C---C---C--- disulfide connectivity 1-6/2-4/3-5. Thus, these properties of toxic peptides derived from different venomous species having similar disulfide folds and similar functions offer valuable insights into the engineering of novel peptide toxins to target the given channel/receptors or even to modulate relevant biological functions. The inhibitory cystine knot (ICK) motif is extensively found commonly in multiple toxic peptides 18, 19. κ-conotoxin found in the marine cone snails have reported to contain ICK-motif helps in delaying the inactivation of the Na channel, thereby blocking the K channel 5. The application of the identical disulfide fold in functionally deviating toxins suggests that toxin scaffolds can provide an entity as lead compounds to treat neurological disorders. The results obtained from disulfide folds’ analysis of various peptide toxins help in providing the required knowledge in the planning of toxin disulfide folds by structure-based drug design.

 

 

Fig. 5. Representative 3D structures of peptide toxins derived from sea anemone venom with its PDB ID. Cysteine disulfides are indicated by the ball and stick model. Structures were processed using PyMOL software.

 

Fig. 6. Concept of unity-diversity and vice versa relationship of toxis peptides obtained from various venomous species and ion channel/receptors of excitable cells. (a) Cone snail explored ICK fold of peptide toxin with cysteine pattern ---C---C---CC---C---C—and connectivity 1-4/2-5/3-6 in different engineering channels targeting peptide toxins. (b) Snake, scorpion, and sea anemone have evolved distinctly different disulfide folds that target the same Kv ion channel.

 

Ion channels/ receptors:

Well-characterized peptide toxins that target K(+) channel include κ-conotoxin, κ-hefutoxin, BgK toxin, ShK toxin, hanatoxin-1, maurotoxin, charybdotoxin, and dendrotoxin-I. These peptide toxins may have different binding sites and are capable of targeting different isoforms of the K(+) channels (Hille 2001). The peptide toxins that target Na(+) channel mainly are as follows huwentoxin-IV, ACTX toxin, ATX1a toxin, B-IV toxin, ω-conotoxin, κ-atracotoxin-HvI, AahII toxin, crotamine, ω-conotoxin KIIIA, BJ-XtrIT toxin, μO-conotoxin MrVIA. These peptide toxins may also have different binding sites and target different isoforms of the Na(+) channels.

 

Well-characterized peptide toxins that target Ca(2+) channel includes Ptu 1 toxin, ω-conotoxin GVIA, three-finger toxin FS2, KP4 toxin, and ω-agatoxin. These peptide toxins may also have different binding sites and different target isoforms of the Ca(2+) channels. Well-characterized peptide toxins that target Cl(-) channel is chlorotoxin derived from a scorpion. Well-characterized peptide toxins that nAChRs include α-conotoxin from cone snails and α-bungarotoxin from snake venom. αA-conotoxin targets nAChRs. α-conotoxin MrVIA targets the norepinephrine transporter. Maurocalcine targets the ryanodine receptor. Other function of peptide toxins includes antimicrobial activity, and hemolytic activity, and induces various behavioural symptoms in mice.

Complex structures of peptide toxins with ion channels/receptors:

Characterization of binding of peptide toxins with ion channels/receptors provides valuable insights on the mode of interaction with macromolecular proteins. Co-crystal structures of peptide toxins with channel/receptor have been studied using X-ray crystallographic method. The co-crystal structures of toxins with channel/receptor were α-conotoxin with acetyl choline-binding protein, α-cobratoxin with acetyl choline-binding protein, fascicullin with acetylcholinesterase, charybdotoxin with K (+) channel, psalmotoxin with acid-sensing ion channels (ASICs) and con-ikot-ikot with AMPA receptor. Fig. 8 shows the 3D-structures of co-crystal structures of toxins with channel/receptor.

 

The PDB ID of toxin and channel/receptor complex is as follows: α-cobratoxin-AChBP (1YI5), α- conotoxin-AchBP (2BR8), Con-ikot-ikot- AMPA (4U5D), carybdotoxin-Kv channel (4JTA), faciculin-acetylcholine esterase (1F8U), and double knotted toxin-TRP channel (5IRX). It is apparent from Fig. 8, toxins interact with specific locations of targeting macromolecular proteins. As predictable, it was observed that pentameric acetyl choline-binding protein binds to four binding sites for peptide toxin as it contains five binding sites for toxin and tetrameric channels. Interestingly, the α-conotoxin and α-cobratoxin bind to the same acetyl choline-binding protein (AChBP). Both toxins have the same binding pocket and bind at five positions of the pentameric channel. α-Conotoxin has cysteine pattern ---CC---C---C--- with disulfide connectivity 1- 3/2-4. α-Cobratoxin has cysteine pattern ---C---C--- C---C---C---C--- C---C--- C---C--- with disulfide connectivity 1-3/2-6/4-5/7-8/9-10. These two toxins have unrelated structures and are derived from different venomous species. α-Conotoxin was obtained from cone snails, and α-cobratoxin was isolated from snake venom. Yet, these toxins target nAChRs with picomolar concentration and demonstrate a high degree of specificity for nAChRs.

 

Fig. 8 shows the binding pocket of α-cobratoxin and α-conotoxin with AChBP. It is apparent from Fig. 8, α-cobratoxin and ω-conotoxin has the same binding pocket which suggests that the structures of toxins can be minimized without compromising their activity, showing their potential as templates for drug design using peptide toxins. The relatively accessible surface area of peptide toxins can be calculated using the ASA view tool, thereby determining the interacting surface of the peptide toxins with ion channels and receptors 20. RASA of toxin in unbound and bound form with the receptor can be deduced using coordinates of the 3D-structure of the toxin by uploading to the ASA View tool 20. The difference in RASA of toxin between unbound and bound forms provides direct evidence for an interacting surface of the toxin with the receptor. For example, fasciculin-II has been utilized for further studies as it acts on acetylcholine esterase. For the identification of the interacting residues of fasciculin-II with acetylcholine esterase, we have subjected the unbound form of fasciculin-II (PDB ID: 1FSC) and the bound form of fasciculin-II (PDB ID: 1F8U) for ASA view software. Fig. 9 shows the difference in RASA of amino acid residues of fasciculin between the unbound and bound forms of the toxin with acetylcholine esterase. It is found that T-8, T-9, R-11, A-12, R-27, P-30, P-31, K-32, M-33, V-34, N-47, E-49, and Y-61 residues of fasciculin-II interact with acetylcholine esterase.

 

Fig. 7. Co-crystal structures of peptide toxins with ion channels/receptors. (a) α-Cobratoxin with Acetyl Choline Binding Protein (AChBP). (b) α-Conotoxin with Acetyl Choline Binding Protein (AChBP). (c) charybdotoxin with K (+) channel. (d) Fascicullin with Acetylcholinesterase. (e) Double-knotted toxin with TRP channel. (f) Con-ikot-ikot peptide toxin with AMPA receptor

 

Fig. 8. Binding of peptide toxin to acetyl choline-binding protein (AChBP). (a) α-Cobratoxin derived from the snake and its interacting surface of AChBP. (b) α-Conotoxin derived from the snail and its interacting surface of AChBP. The interacting surface was identified using PyMOL software. Note. Unrelated toxins have similar binding pockets with AChBP. (c) α-Conotoxin-AChBP complex,α-Conotoxin-AChBP complex and superpositionof α-Conotoxin-AChBP complex α-Conotoxin-AChBP complex with binding site.

 

Fig. 9. The difference is a RASA of amino acid residues of fasciculin-II between unbound isolated-form bound form with acetylcholine esterase. The dashed line at 20% can be used to identify more profoundly interacting amino acid residues of fasciculin-II with acetylcholine esterase. ASA view was used to calculate the RASA of amino acids of fasciculin-II


 

Table S1: Classification of venom peptide toxins derived from snake concerning with cysteine pattern and disulfide connectivity

Sl. No

Observed cysteine patterns in peptide toxin database

Accession number

Name of the toxin

Disulfide connectivity

Fold

Main target

1

--C---C---C---C--

P13208

Sarafotoxin-b

 

-C-X1-C-X7-C-X3-C—X6

α

Agonist of EDNRA and EDNRB

B6D434

Propeptide of Cathelicidin-BF

 

X58-C-X10-C-X10-C-X16-C—X41

---------

---------

2

--CC---C---C--

 

P0C547

Cardiotoxin-like basic polypeptide ah

X1-CC-X11-C—X3-C-X2

---------

Hemolytic activity

3

--C--C--C--C--C--C--

 

P00979

Kunitz-type serine protease inhibitor homolog (Dendrotoxin-1)

 

X6-C—X8-C-X15-C-X7—C-X12—C-X3—C—X3

310ββα

Blocks Kv channels

J3SBN9

C-type lectin 6

 

X1-C-X10 - C-X16—C-X61-C-X14—C-X7—C—X2

-------

Modulates platelet aggregation

4

--C--C--C--C--CC--

 

P01476

Myotoxin-A (Crotamine)

 

X3-C—X6-C-X6- C-X11—C-X5—CC—X5

 

αβββ

Cell-penetrating peptide

5

--C-C-C-C-C-CC-C--

B3EWH9

 

P01414

Three-finger hemachatoxin

Toxin FS-2

 

X2-C-X11-13-C—X4-6-C-X16-C-X1-3-C- X10-CC-X4—C—X1-2

ββ βββ

 

β 1β1 β 2 β2β2

Cardiotoxic and hypotensive activities Specific blocker L-type Cav

channel

 

6

--C-C-C-C-CC-C-C--

 

P60589

 

Nawaprin

 

X6-C-X12-C—X3-C-X5-C-X5—CC-X3—C-X4-C—X5

βαβββ

Damages membranes of susceptible

bacteria

 

7

--C-CC-C-C-C-C-C--

Q7ZZM2

Disintegrin jerdostatin

 

-C-X4-CC—X2-C-X8-C-X9-C-X4-C-X1-C-X5

βββ

Inhibits the adhesion of alpha-1/beta-1-

K562

 

8

--C-C-C-C—C-CC-C--

A7X4T2

Toxin 3FTx-Oxy6

 

X2-C-X11-C-X6-C-X17-C-X3-C-X7-CC-X4-C-X2

αβ

----------

Table S2: Classification of venom peptide toxins derived from scorpion concerning with cysteine pattern and disulfide connectivity

Sl. No

Observed cysteine patterns in peptide toxin database

Accession number

Name of the toxin

Disulfide connectivity

Fold

Main target

1

--C--C--CC--C--C--

P60254

Maurocalcin

 

X2-C-X6-C-X5—CC—X3-C—X10-C—X1

ββββ (ICK)

Potently and reversibly modifies RYR1

2

--C--C--C--C--C--C--

P13487

 

 

R4GUQ3

Potassium channel toxin alpha-KTx 1.1 (Charybdotoxin)

Neurotoxin alpha-KTx 28.1 (Toxin ImKTx104)

 

X1-6-C-X5-C-X3—C-X6-10—C-X4—C-X1—C—X1-2

 

β

Inhibits Kv channel

B3A0L5

Kappa-buthitoxin-Tt2b

 

X1-C—X4-C-X3-C-X8—C-X3—C-X1-C-X2

 



Blocks sheker and hKv1.2 channel

P58504

Potassium channel toxin alpha-Tx 10.2

 

X2-C—X4-C-X3—C-X9—C-X4—C-X1—C—X3

 

-------

Blocks sheker- B Kv channels

3

--C-C-C-C-C-CC-C--

P0C5F3

Venom peptide La1

 

X4-C-X18-C-X4-C-X13-C-X8-C-X13-CC-X4-C-X1

4

--C-C-C-C-C-C-C-C--

P01484

Alpha-mammal toxin AaH2 (Neurotoxin 2)

 

X11-C-X3—C-X5—C-X3—C-X9—C-X9—C-X1—C-X14—C—X1

βββ

Binds site-3 of Nav channels

P0C168

Potassium channel toxin alpha-KTx 12.2 (Butantoxin)

 

X1-C-X2—C-X4—C-X5—C-X3—C-X10—C-X4—C-X1—C—X2

βββ

Inhibits calcium activated Kv

channels

 

 

P0DJ31

Potassium channel toxin alpha-KTx 23.1 (Toxin Vm24)

 

X5-C—X5-C-X3—C-X4—C-X4—C-X4—C-X1—C-X2—C—

βββ

Blocks hKv1.3/KCNA3

Potassium channels

 

 

P80719

Potassium channel toxin alpha-KTx 6.2 (Maurotoxin)

 

X2-C-X5-C-X3-C-X5-C-X4-C-X4-C-X1-C-X2-C-

ββ

Blocks Kv channel

 

 

Q5MJP5

Phaiodotoxin

 

X12-C-X9—C-X3—C-X10—C-X11—C-X1—C-X10—C-X7—C—X1

 

--------

Nav channel specific neurotoxin

5

--C-C-CC-C-C-C-C--

P0C174

Potassium channel toxin epsilon-KTx 1.1 ( TsPep1)

 

X3-C-X2—C-X3-CC-X3—C-X4-C-X4-C-X1-C-X1

 

ββββ

Blocks Kv channels

 

6

--C-C-C-CC-C-C-C--

P56637

Beta-insect excitatory toxin Bj-xtrIT

 

X15-C—X10-C—X3-C-X10—CC-X3—C—X1-C—X19-C—X7



Bind Nav channels

 

7

--CC-C—C-C-C-C-C--

O96669

Putative potassium channel blocker

 

X4-CC-X10-C-X4—C-X2-C-X1-C-X7-C-X1-C-X8

 

-------

Inhibits potassium

channels

 

Table S3: Classification of venom peptide toxins derived from spider concerning with cysteine pattern and disulfide connectivity

Sl. No

Observed cysteine patterns in peptide toxin database

Accession number

Name of the toxin

Disulfide connectivity

Fold

Main target

1

--C--C--CC--C--C--

P56852

Kappa-theraphotoxin- Gr1a (Hanatoxin-1)

 

X1-C-X6-C-X5—CC—X4-C—X6-C—X7

310 ββ (ICK)

Inhibits Kv channels

D2Y252

Hainantoxin-XVIII-2

 

-C-X11-C-X1—CC—X18-C—X26-C—X1

-------

-------

2

--C--C--C--C--C--C--

O46166

U1-agatoxin-Ta1a (Insecticidal toxin 1)

 

X5-C-X15-C-X2-C-X6-C-X3—C-X8-C-X5

 

Paralyses insect

D2Y2H2

Hainantoxin-XVIII-4

 

X8-C—X3-C-X1—C-X6—C-X12—C-X26—C—X1

-------

-------

P82959

U1-theraphotoxin-

Hs1a (Huwentoxin-2)

 

X3-C—X3-C-X9—C-X4—C-X5—C-X4—C—X3

 

ββββ

Blocks neuromuscular transmission

B6DCK8

U1-lycotoxin-Ls1g

 

X9-C—X6-C-X9—C-X1—C-X13—C-X1—C—X21

 

-------

 

-------

3

--C-C-C-C-C-C-C-C--

P0CC18

U1-theraphotoxin-

Lp1a (Lasiotoxin)

 

X3-C-X3—C-X8—C-X4—C-X1—C-X10—C-X5—C-X4—C—X3

--------

Toxic to mice

4

--C-C-CC-CC-C-C--

P82228

Kappa-hexatoxin-Hv1c

 

X2-C—X6-C—X2-CC-X1—CC-X4-C—X9-C-X5

 

ββ

Inhibits KCa channels

5

--C-C-CC-C-C-C-C--

P60272

 

U2-hexatoxin-Hi1a (Agatoxin)

 

X1-C-X6-C-X7-CC-X4-C-X1—C-X5-C-X1-C-X5

 

βββ

Inhibits Nav channels

 

 

P61095

U2-segestritoxin-Sf1a

 

X2-C—X6-C-X7-CC-X2—C-X1-C-X15-C-X1-C-X4

 

ββ

Insecticidal toxin

 

 

D2Y2E0

U8-Theraphotoxin- Hhn1b

 

X1-C-X5-C-X4-CC-X8-C-X9-C-X12-C-X7-C-X9

 

-------

 

-------

6

--C-C-C-CC-C-C-C--

D2Y2P2

 

Hainantoxin-XVIII.2

 

-C—X7-C—X3-C-X1—CC-X5—C—X12-C—X26-C—X1

 

-------

 

-------

7

--C-C-CCC-C-C-C--

P13494

Delta-hexatoxin-Hv1a ( Delta-atracotoxin)

 

-C-X6-C-X5-CCC-X3-C-X10-C-X10-C-

 

βββ310

Inhibits tetrodotoxin sensitive Nav

channel

 

Table S4: Classification of venom peptide toxins derived from Conus corresponding to cysteine pattern and disulfide connectivity

Sl. No

Observed cysteine patterns in peptide toxin database

Accession number

Name of the toxin

Disulfide connectivity

Fold

Main target

1

--C---C---C---C--

Q0N4U8

Alpha/kappa- conotoxin pl14a

 

X6-C-X3-C-X10-C-X1-C—X1

α310310

Inhibits Kv1.6 channels

P84704

Kappa-conotoxin vil14a

 

X5-C-X3-C-X11-C-X3-C—X1

αα

Blocks Kv channels

2

--CC---C---C--

P01519

Alpha-conotoxin GI

 

X1-CC-X3-C—X5-C-

 

Inhibits nAChR

P58808

Chi-conotoxin MrIA

 

X3-CC-X4-C—X2-C-

β

Inhibit NET transporter

3

--C---C---CC--

P0DJC3

Conotoxin qc16a

 

X1-C-X2-C-X4-CC-

β turn

Reversible depression

symptom in mice

P86942

Conotoxin pc16a

 

X1-C-X1-C-X5-CC-

Scaffold

Neurotoxin

4

--CC------------CC-

Q9U6Z6

Conotoxin p5a

 

X1-CC-X5-CC-X2

---------

---------

5

--C--C--CC--C--C--

P01522

Omega-conotoxin GVIA

 

X0-C-X6-C-X6—CC—X2-C—X6-C—X1

βββ (ICK)

Inhibits N-type Cav channel

6

--CCC--C--C--C--

P28879

 

Alpha-conotoxin S2

 

X1-CCC-X3-C-X5-C-X3-C—X1

β

Binds to nAChR

7

--C--C--CC--CC--

Q45RU8

Conotoxin S5.1

 

X11-C—X9-C-X10—CC-X5—CC—X3

 

------

 

-------

8

--CC--C--C--C--C--

P0C1W8

Alpha-conotoxin OIVB ( αA-conotoxin-OIVB)

 

-CC-X6-C-X2-C-X1-C-X3-C-X1

 

------

Inhibit nAChR

P55963

Alpha-conotoxin PIVA ( αA-conotoxinPIVA)

 

X1-CC-X7-C-X2-C-X1-C-X6-C-X2

 

βα

Inhibit nAChR

9

--CC--C--C--CC--

P01523

Mu-conotoxin GIIIA

 

X2-CC—X5-C-X4—C-X4—CC—X1

 

βα

Blocks Nav channels

P0C1M9

Conotoxin mr3a

 

X1-CC—X4-C-X3—C-X2—CC—X1

Triple turn

Convulsions in mice

Q5EHP3

Conotoxin mr3e

 

X1-CC—X4-C—X3-C—X1-CC-X1

β

 

-------

10

--C--C--C--CC--C--

D0PX84

Conotoxin im23a (Im23.1)

 

X3-C-X6-C-X3-C-X9-CC-X14-C-X1

β

Induces excitatory symptoms in

mice

11

--C--CC--C--C--C--

A0A0R4I952

Mo3964

 

X3-C-X6-CC-X8-C-X5-C-X6-C-X3

βββββ

Decreases out word Kv current

12

--C-C-CC-CC-C-C--

P0DKN2

 

Turripeptide Lol11.1

 

-C—X6-C-X8-CC-X5—CC—X3-C—X5-C—X21

 

------

Inhibiting Kv channels

 

 

 

Q7Z094

Iota-conotoxin RXIA (r11a)

 

X4-C—X6-C—X5-CC-X1—CC-X4-C—X10-C—X8

ββββ

Agonists of Nav channels

13

--C-C-C-C-CC-C-C--

A6YR24

 

Mu-conotoxin-like Cal 12.1.1d

 

X2-C—X7-C-X4-C-X1-C-X8-CC-X4—C-X5-C-X6

-------

Block Nav channels

14

--C-C-CC-C-C-C-C--

P0CI11

Augerpeptide hheTx4

 

X3-C-X4—C-X3-CC-X4—C-X1-C-X9-C-X1-C-X2

--------

 

--------

15

--C-C-C-C-CC-CC--

P0DL31

Omega-conotoxin RsXXVIA

 

-C—X4-C—X2-C-X5-C-X10-CC-X3-CC-X8

-------

Blocks Cav channel

16

--C-C-C—C-C-CCC--

P0CI09

Augerpeptide hheTx2

 

X1-C—X3-C-X2-C-X4-C-X1-C-X10-CCC-

---------

--------

17

--C—C-CC—C-CC-C--

B4YSU8

 

Conotoxin ca17a

 

-C-X6-C-X7-CC-X4-C-X4-CC-X5-C-

---------

--------

Table S5: Classification of venom peptide toxins derived from sea anemone corresponding to cysteine pattern and disulfide connectivity

Sl. No

Observed cysteine patterns in peptide toxin database

Accession number

Name of the toxin

Disulfide connectivity

Fold

Main target

1

--C--C--C--C--C--C--

P29187

Kappa-stichotoxin-She3a (Kappa-SHTX- She3a)

 

X2-C—X8-C-X4—C-X10—C-X3—C-X2—C—

β

Inhibits Kv channels

 

 

2

--CC--C--C--C--C--

P01535

Delta-actitoxin- Avd2a (ATX III)

 

X2-CC-X1-C-X4-C-X5-C-X4-C-X5

βββ

Inhibits inactivation of Nav channels

3

-C--C--C--C--CC--

P01533

Delta-actitoxin- Avd1a

 

X3-C—X1-C-X20—C-X6—C-X8—CC—X2

ββββ

Binds Nav channels

4

--C-C-C-C-C-C-C-C--

Q3C258

U-actitoxin-Aeq5a

 

X10-C-X3—C-X6—C-X5—C-X5—C-X2—C-X6—C-X4—C—X1

---------

--------

 

 


CONCLUSION:

Structural analysis of natural peptide toxins, which designed neuronal circuits modulating provided insights for structure-based drug design where peptide toxins can be used as scaffolds. Venom has hundred different toxins found to cause lethality, paralysis, severe pain, and unbearable irritations upon direct injection into victims. However, the separation of the venom into individual peptide toxin components has proven their applications in neuroscience and as lead compounds in therapeutics. Some of the toxins are on the market, such as Prialt (ω-conotoxin), for the treatment of neurological disorders. Millions of years of effort on the evolution in the design of peptide toxins to achieve exquisite specificity and selectivity for neuronal circuits offers valuable insights and inputs for structure-based drug design using peptide scaffolds. The distance of disulfide bond length of cysteine residues is 2.01 ± 0.01A. Given the optimal molecular weight and specificity of peptides compared to conventional small molecule drugs, peptides are considered future next-generation drug candidates. Alpha Fold predictions are quite accurate in many circumstances, although it is crucial to remember that the accuracy varies depending on the protein or peptide being predicted. Furthermore, AlphaFold has not been specially optimised for predicting the structures of neuroactive peptides, which may be difficult due to their tiny size and flexibility. As a result, any predicted structures must be validated using experimental techniques such as X-ray crystallography or NMR spectroscopy. It is challenging in the absence of experimental validation.

 

ACKNOWLEDGEMENT:

The authors thank our prestigious institute and other people who are involved in this study for their direct and indirect contributions.

 

REFERENCES:

1.      R. J. McCleary and R. M. Kini, Non-enzymatic proteins from snake venoms: a gold mine of Pharmacological tools and drug leads. Toxicon. 2013; 62: 56-74.

2.      R. C. R. de la Vega, E. F. Schwartz and L. D. Possani, Mining on scorpion venom biodiversity. Toxicon. 2010; 56: 1155-1161.

3.      J. J. Smith, V. Herzig, G. F. King and P. F. Alewood, The insecticidal potential of venom peptides. Cellular and Molecular Life Sciences. 2013; 70: 3665-3693.

4.      B. M. Olivera, P. Showers Corneli, M. Watkins and A. Fedosov, Biodiversity of cone snails and other venomous marine gastropods: evolutionary success through neuropharmacology, Annu. Rev. Anim. Biosci. 2014; 2: 487-513.

5.      H. Terlau and B. M. Olivera, Conus venoms: a rich source of novel ion channel-targeted peptides. Physiological Reviews. 2004.

6.      R. J. Lewis and M. L. Garcia, Therapeutic potential of venom peptides. Nature Reviews Drug Discovery. 2003; 2: 790-802.

7.      P. Escoubas, Molecular diversification in spider venoms: a web of combinatorial peptide libraries. Molecular Diversity. 2006; 10: 545-554.

8.      B. L. Sollod, D. Wilson, O. Zhaxybayeva, J. P. Gogarten, R. Drinkwater and G. F. King, Were arachnids the first to use combinatorial peptide libraries? Peptides. 2005; 26: 131-139.

9.      B. M. Olivera, D. R. Hillyard, M. Marsh and D. Yoshikami, Combinatorial peptide libraries in drug design: lessons from venomous cone snails. Trends in Biotechnology. 1995; 13: 422-426.

10.   O. Buczek, G. Bulaj and B. Olivera, Conotoxins and the posttranslational modification of secreted gene products, Cellular and Molecular Life Sciences CMLS. 2005; 62: 3067-3079.

11.   P. C. V. Govindu, P. Chakraborty, A. Dutta and K. H. Gowd, Structural space of intramolecular peptide disulfides: Analysis of peptide toxins retrieved from venomous peptide databases, Computational Biology and Chemistry. 2017; 68: 194-203.

12.   Q. Kaas, R. Yu, A.-H. Jin, S. Dutertre and D. J. Craik, ConoServer: updated content, knowledge, and discovery tools in the conopeptide database, Nucleic Acids Research. 2012; 40: D325-D330.

13.   F. Jungo, L. Bougueleret, I. Xenarios and S. Poux, The UniProtKB/Swiss-Prot Tox-Prot program: a central hub of integrated venom protein data, Toxicon. 2012; 60: 551-557.

14.   V. Herzig, D. L. Wood, F. Newell, P.-A. Chaumeil, Q. Kaas, G. J. Binford, G. M. Nicholson, D. Gorse and G. F. King, ArachnoServer 2.0, an updated online resource for spider toxin sequences and structures. Nucleic Acids Research. 2010; 39: D653-D657.

15.   Q.-Y. He, Q.-Z. He, X.-C. Deng, L. Yao, E. Meng, Z.-H. Liu and S.-P. Liang, ATDB: a uni-database platform for animal toxins. Nucleic Acids Research. 2007; 36: D293-D297.

16.   J. B. Jordan, L. Poppe, M. Haniu, T. Arvedson, R. Syed, V. Li, H. Kohno, H. Kim, P. D. Schnier and T. S. Harvey, Hepcidin revisited, disulfide connectivity, dynamics, and structure. Journal of Biological Chemistry. 2009; 284: 24155-24167.

17.   A. Albert, J. J. Eksteen, J. Isaksson, M. Sengee, T. Hansen and T. Vasskog, General approach to determine disulfide connectivity in cysteine-rich peptides by sequential alkylation on solid phase and mass spectrometry. Analytical Chemistry. 2016; 88: 9539-9546.

18.   P. K. Pallaghy, R. S. Norton, K. J. Nielsen and D. J. Craik, A common structural motif incorporating a cystine knot and a triple‐stranded β‐sheet in toxic and inhibitory polypeptides. Protein Science. 1994; 3: 1833-1839.

19.   J. C. Gelly, J. Gracy, Q. Kaas, D. Le‐Nguyen, A. Heitz and L. Chiche, The KNOTTIN website and database: a new information system dedicated to the knottin scaffold. Nucleic acids Research. 2004; 32: D156-D159.

20.   S. Ahmad, M. Gromiha, H. Fawareh and A. Sarai, ASAView: database and tool for solvent accessibility representation in proteins. BMC Bioinformatics. 2004; 5: 51.

 

 

Received on 09.10.2023      Revised on 06.06.2024

Accepted on 12.11.2024      Published on 24.12.2024

Available online from December 27, 2024

Research J. Pharmacy and Technology. 2024;17(12):5825-5838.

DOI: 10.52711/0974-360X.2024.00885

© RJPT All right reserved